PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G35020.1
Common NameLOC102718281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25539.8 Da    PI: 9.2126
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G35020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.2e-29959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  OB06G35020.1  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
                  79***********************************************96 PP

2K-box89.85e-3071168198
         K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                   yq+++g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL+++eL+ Leq+++ +lk++R +K++++++q+e+ +kk k   e+ k+L+++
  OB06G35020.1  71 YQQATGTSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFEELRGLEQNVDAALKEVRHRKYHVITTQTETYKKKVKHSYEAYKNLQQE 167
                   89999*****************************************************************************************998 PP

         K-box  98 l 98 
                   l
  OB06G35020.1 168 L 168
                   6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-37295IPR002100Transcription factor, MADS-box
CDDcd002652.22E-43280No hitNo description
PRINTSPR004042.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-2282168IPR002487Transcription factor, K-box
PROSITE profilePS5129715.04684174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
STDIKGIFDR YQQATGTSLW VEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDSLEFEE  120
LRGLEQNVDA ALKEVRHRKY HVITTQTETY KKKVKHSYEA YKNLQQELGL REDPAFGFVD  180
NTGAGGWDGG AGAGAAADMY AFRVVPSQPN LHGMAYGGSH DLRLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-16273170Myocyte-specific enhancer factor 2A
3kov_B1e-16273170Myocyte-specific enhancer factor 2A
3kov_I1e-16273170Myocyte-specific enhancer factor 2A
3kov_J1e-16273170Myocyte-specific enhancer factor 2A
3p57_A1e-16273170Myocyte-specific enhancer factor 2A
3p57_B1e-16273170Myocyte-specific enhancer factor 2A
3p57_C1e-16273170Myocyte-specific enhancer factor 2A
3p57_D1e-16273170Myocyte-specific enhancer factor 2A
3p57_I1e-16273170Myocyte-specific enhancer factor 2A
3p57_J1e-16273170Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033230.0AB003323.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E20969.
GenBankAK2892480.0AK289248.1 Oryza sativa Japonica Group cDNA, clone: J100079D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656482.11e-170PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-149MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLJ3MHK81e-170J3MHK8_ORYBR; Uncharacterized protein
STRINGOB06G35020.11e-170(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-66MIKC_MADS family protein